PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_111188g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 879aa    MW: 95225.1 Da    PI: 7.3747
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_111188g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.7e-095595961954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  MA_111188g0010 559 FEHflHPYPKDADKHMLARQTGLTRNQVSNWFINARVR 596
                     554459******************************88 PP

2BELL124.54e-40422493172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kkakL+ +l+eVd+rY+qy++q+q+v+ssFea ag g+ak YtslAl++iSrhFrcL+dai++qi
  MA_111188g0010 422 ERQELQMKKAKLVAMLDEVDQRYRQYYHQMQIVVSSFEATAGFGAAKTYTSLALQTISRHFRCLRDAISGQI 493
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-64335491IPR006563POX domain
PfamPF075262.7E-52340490IPR006563POX domain
PROSITE profilePS5007112.179537600IPR001356Homeobox domain
SMARTSM003898.1E-9540604IPR001356Homeobox domain
CDDcd000866.07E-12540601No hitNo description
SuperFamilySSF466891.07E-16542607IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28543606IPR009057Homeodomain-like
PfamPF059205.1E-18557596IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 879 aa     Download sequence    Send to blast
MSARGGGHTS TRIANIKSWA HINFSSVQIS IAIVIPAKEA QRTPQKKFDN PGQHSSNIQA  60
DNMQTLYLMN PGYAGYTDAT TSGNMVLLNH SVGNTLPANN LAGGQPSQHF IGIPLPTAPL  120
SQRSSLGVMG NSPTSQQDIN SNLLASRMGG HPYNVWRNGG NELTFMQTTD AAGSSQSLSG  180
HLNNSGSMGH QPVAEISQMG LRRAPMSSIQ EQQSGMLPSG LSLQLEHSHG STGHGQGLSL  240
SLSPQQPSTV QLPSFQNQPT DSDINCPGIS TTSEENMSRT DRGTSKWAGS LSAFRASSRD  300
GMLGSGFSNT GFSGNLLAPG ANKQMHLDSS STGAAGLSNV LTGSKYLKAA QQLLDEVVNV  360
GKGIKPDSAK HQKSQSWIGT TANKENSAAE GGGKDGAAAA PTWRSTSAQE TNDRPSELSP  420
AERQELQMKK AKLVAMLDEV DQRYRQYYHQ MQIVVSSFEA TAGFGAAKTY TSLALQTISR  480
HFRCLRDAIS GQIRMTSKSL GEEDSTVSGK GETSRLRFVD QQLRQQRALQ QLGMIQQHAW  540
RPQRGLPERS VSVLRAWLFE HFLHPYPKDA DKHMLARQTG LTRNQVSNWF INARVRLWKP  600
MVEEMYNEET KETEVEHGSN EKTGKESGEK KEDALSKEGA AGNNGNIHDH QSGKTTKLDN  660
IAQDGGADEK PTGAPKSENA SNLINARNQS FGMGGTSDSQ IFNETENEGI RQGQLKKARN  720
GTQECTSLLS PNMSIEVDLK SDETNSGEFG DHKFSDERQN TEDYSFVHNA MVHPDNSGSF  780
GSYQIGDLSR YGHESFTPRF SGSGGVSLTL GLQRTDGLSL QGTQQNYMST QSLALGRRHD  840
LGGNSSDYCN IETSAAHPAN IYENINIQPR KCFATQLMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-16546603158Homeobox protein Meis1
4xrs_B3e-16546603158Homeobox protein Meis1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1042770.0BT104277.1 Picea glauca clone GQ02808_H08 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9RM180.0A0A0C9RM18_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11489_4138 transcribed RNA sequence
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13316172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.35e-94BEL1-like homeodomain 1